top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|39687502|39727548|+|10|circRNA|COG6|NM_020751|9,10,11,12,13,14,15,16,17,18

COG6

Open Reading Frame (ORF)

MNLEQPEEVQLFVDLLMRSQEGAPEVHLDQLKCILMTL

Peptide

SQEGAPEVHLDQLKCILMTL

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

20

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page