top of page

CircRNA

Gene

chr13|28277236|28281379|+|3|circRNA|PAN3|ENST00000380958.7|15,16,17

PAN3

Open Reading Frame (ORF)

MRGRTSRSDIIRKSCVGFGLQLFGRNSAREFTESHGTGDNQLFL

Peptide

TSRSDIIR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page