top of page

CircRNA

Gene

chr13|28260446|28281379|+|10|circRNA|PAN3|ENST00000380958.7|8,9,10,11,12,13,14,15,16,17

PAN3

CircRNA UID

circPAN3(8,9,10,11,12,13,14,15,16,17)

Open Reading Frame (ORF)

MRGRSVSKLSYLSSNCTSRCLYATESKRTFLLHG

Peptide

CLYATESKR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page