top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|28197184|28220378|+|2|circRNA|PAN3|ENST00000503791.5|5,6

PAN3

Open Reading Frame (ORF)

LSNVSQSNMSAFSQVFSHPSMGSPATAGLAPAKEVSPGDAGGEASSDGIKGTKSKEPYWLPC

Peptide

EVSPGDAGGEASSDGIK

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page