top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|28174271|28256539|+|6|circRNA|PAN3|ENST00000503791.5|2,3,4,5,6,7

PAN3

Open Reading Frame (ORF)

LLGLPLFIPPRLLHILLLLPEEEVTLQIQQVTWCLLVPLHLLIILFLRLRLLVR

Peptide

LLGLPLFIPPR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page