top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|23869291|23886506|-|6|circRNA|MIPEP|ENST00000382172.3|7,6,5,4,3,2

MIPEP

Open Reading Frame (ORF)

LKCLEELLSSRDLLAKLVGYSTFSHRALQGTIAKNPGSFWSS

Peptide

ALQGTIAKNPGSFWSS

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page