top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr13|19959957|20031435|+|9|circRNA|ZMYM2|ENST00000610343.4|2,3,4,5,6,7,8,9,10

ZMYM2

Open Reading Frame (ORF)

MQLLQKFLLFKTRNPGMGGPRIAFSPVWCILGRK

Peptide

TRNPGMGGPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page