top of page

CircRNA

Gene

chr13|101283932|101292366|-|3|circRNA|NALCN|ENST00000251127.10|10,9,8

NALCN

Open Reading Frame (ORF)

MFHEDAAGGWQLVAVDVNKPQGRAPACLQELVYSPSMRPPHRKAGCSSCTEQLTAFPVGVPTSISSLSFSSSPGL

Peptide

APACLQELVYSPSMRPPHR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

11

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page