top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|94331699|94379042|-|8|circRNA|CEP83|ENST00000397809.9|14,13,12,11,10,9,8,7

CEP83

Open Reading Frame (ORF)

MSVSQTEKKSTIKLRRNCSELQLPRKRLQDWRKIKKNYVTSCLMLISQKTANEWNNLLEKKSICVKN

Peptide

TANEWNNLLEK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page