top of page

CircRNA

Gene

chr12|89466769|89492115|-|6|circRNA|POC1B|ENST00000393179.8|7,6,5,4,3,2

POC1B

Open Reading Frame (ORF)

LHCKGLTKRNLKRLHFDSPPHLLDIYPRTPHPHEEKVETVEERKILRI

Peptide

TPHPHEEKVETVEER

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page