top of page

CircRNA

Gene

chr12|871264|883568|+|6|circRNA|WNK1|ENST00000535572.5|9,10,11,12,13,14

WNK1

CircRNA UID

circWNK1(9,10,11,12,13,14)

Open Reading Frame (ORF)

LWIKCEKLLKKLMKCSVRMSVWNQRVIRDWRVYKERMTMAFQVLRHRGRARVSHPQVA

Peptide

MTMAFQVLR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page