top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|82895817|82930545|+|2|circRNA|TMTC2|ENST00000551915.5|3,4

TMTC2

Open Reading Frame (ORF)

LKSQSKISEAESAYRNALYYRSNMADMLYNLGRTCRFS

Peptide

SNMADMLYNLGRTCR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page