top of page

CircRNA

Gene

chr12|71626259|71647813|-|20|circRNA|ZFC3H1|ENST00000378743.7|22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3

ZFC3H1

Open Reading Frame (ORF)

MFWREHWKITKTIQKFGAITSDCSQKEEPRTRCRKCVKQLLNMLQIIKAFGLITR

Peptide

QLLNMLQIIKAFGLITR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page