top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|69251128|69260197|+|7|circRNA|CPSF6|ENST00000435070.6|2,3,4,5,6,7,8

CPSF6

Open Reading Frame (ORF)

LVTAISLIKQSKVSADDRCKVLISSLQDCLHGIESKSYGSGSRKLNMVGMIR

Peptide

KLNMVGMIR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page