top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|66203710|66211597|+|4|circRNA|IRAK3|ENST00000261233.8|2,3,4,5

IRAK3

Open Reading Frame (ORF)

LLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQQRDFQAAGWMFVILKSM

Peptide

DFQAAGWMFVILKSM

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page