top of page

CircRNA

Gene

chr12|65239928|65243469|+|4|circRNA|LEMD3|ENST00000308330.2|7,8,9,10

LEMD3

Open Reading Frame (ORF)

LTPCLKIRNMFDPVMCSDGLCRSALHEISMDKRRGGNKADV

Peptide

SALHEISMDK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page