top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|64481841|64486017|+|4|circRNA|TBK1|ENST00000331710.9|8,9,10,11

TBK1

Open Reading Frame (ORF)

LQNCQYLTALSGINAKGDTMADGSSGSTYPCSCKHP

Peptide

LQNCQYLTALSGINAK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page