top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|62470700|62532670|+|12|circRNA|MON2|NM_001278472|2,3,4,5,6,7,8,9,10,11,12,13

MON2

Open Reading Frame (ORF)

LKQNVKPPLKKVLHQHSRQNSRIYSQHQTKWIRKLVQMRGI

Peptide

QNVKPPLKK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page