top of page

CircRNA

Gene

chr12|51684173|51702914|+|7|circRNA|SCN8A|ENST00000550891.4|3,4,5,6,7,8,9

SCN8A

Open Reading Frame (ORF)

LGLLGIISPYDPGLLGKLVSIDLCSIKQRENSLQI

Peptide

LGLLGIISPYDPGLLGKLVSIDLCSIK

ORF Found in Long-Read

false

Peptide Length

27

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

21

Number of Amino Acids from 5' Exons

6

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page