top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|51377194|51379884|-|2|circRNA|GALNT6|ENST00000543196.6|3,2

GALNT6

Open Reading Frame (ORF)

LGTATTGPQCPWGRWKSISEEQVDPPGDPGKGRRL

Peptide

SISEEQVDPPGDPGK

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page