top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|50728547|50731537|+|2|circRNA|DIP2B|NM_173602|30,31

DIP2B

Open Reading Frame (ORF)

LALHSQPVQNKGHFLLLFSDGALHQRSWEPSGSAKDVPLCSERSVSSHQAPV

Peptide

GHFLLLFSDGALHQRSWEPSGSAK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page