top of page

CircRNA

Gene

chr12|31423596|31452476|-|7|circRNA|DENND5B|ENST00000628277.2|12,11,10,9,8,7,6

DENND5B

Open Reading Frame (ORF)

LWTLTTILLSCLKNFHSSPIKWILSKNSLRFLFNLGSLLRAAYIAVRVPAN

Peptide

NSLRFLFNLGSLLR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page