top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|20621295|20654205|+|11|circRNA|PDE3A|NM_000921|5,6,7,8,9,10,11,12,13,14,15

PDE3A

Open Reading Frame (ORF)

LENGWKTAMSQEILMTQKKRRKKHQHQMKRKPVKIMNLQS

Peptide

TAMSQEILMTQK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page