top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|15640702|15662099|-|9|circRNA|EPS8|NM_004447|17,16,15,14,13,12,11,10,9

EPS8

Open Reading Frame (ORF)

LDIVRPPESGLGRADPPYTHTIQLRNQGSIMSRKKHLR

Peptide

NQGSIMSR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page