top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|133182030|133187871|+|1|ciRNA|CTD-2140B24.4|ENST00000540096.2|6

CTD-2140B24.4

Open Reading Frame (ORF)

LSGSHFFSASNPAFPEVKPALFSNVFLSHLCDVTPISFSPKEIMLAKVNLLLSPQVSRGFLSFLKSSP

Peptide

GFLSFLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page