top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|132798339|132813419|-|6|circRNA|GOLGA3|ENST00000204726.7|9,8,7,6,5,4

GOLGA3

Open Reading Frame (ORF)

MTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEALQILPCPWRRRSRSDFRLGSGWKSSSNSTG

Peptide

IAAQLQGIEALQILPCPWRR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

11

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page