top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|132664003|132681279|-|22|circRNA|POLE|ENST00000320574.9|23,22,21,20,19,18,17,16,15,14,13,12,11,10,9,8,7,6,5,4,3,2

POLE

Open Reading Frame (ORF)

MVRPAQQLPRKFCLQDDQCEEAQSDHLLPRRHVEHHGQGMMAPLPQFRHSSAWNGVSGRIRWICGLVLSG

Peptide

MVRPAQQLPR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page