top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|132028016|132044953|+|11|circRNA|EP400|ENST00000389561.6|27,28,29,30,31,32,33,34,35,36,37

EP400

Open Reading Frame (ORF)

MCLMYEATPIPEAKLPPVYVRKERKRHKTDPSGGKDQTLERAPGSDLFSQRAALFSSSSLWQRLAKDLCPA

Peptide

DQTLERAPGSDLFSQR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page