top of page

CircRNA

Gene

chr12|132005076|132006877|+|3|circRNA|EP400|ENST00000389561.6|13,14,15

EP400

CircRNA UID

circEP400(13,14,15)

Open Reading Frame (ORF)

MLHLCCMGLSEIIRRLAWTGWPNFTGRISMAYWQMKLGWVKQCRSLLFLPT

Peptide

MLHLCCMGLSEIIRR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page