top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|131992172|132006302|+|4|circRNA|EP400|ENST00000389561.6|11,12,13,14

EP400

Open Reading Frame (ORF)

LSRRQGESQGLGSHRLAFHHGSVQSCREDEYREAKRQGHCGRHCGG

Peptide

RQGESQGLGSHR

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page