top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|124344951|124346563|-|1|ciRNA|NCOR2|NM_001077261|32

NCOR2

Open Reading Frame (ORF)

LLKRGRGPGGLATKVPVWTVTPPFPHHPFCLEGKHLSPDLSVPGAESLRAGSIGSGC

Peptide

GPGGLATK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page