top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|118255447|118266759|-|2|circRNA|TAOK3|ENST00000419821.6|3,2

TAOK3

Open Reading Frame (ORF)

LAIMRKGVLKDPEIADLFYKDDPEELFIGLHEIGHGSFGAVYFVAS

Peptide

DDPEELFIGLHEIGHGSFGAVYFVAS

ORF Found in Long-Read

false

Peptide Length

26

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page