top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|112053557|112081134|-|11|circRNA|NAA25|NM_024953|15,14,13,12,11,10,9,8,7,6,5

NAA25

Open Reading Frame (ORF)

MLLRPNPVTSHSGFFTPTRKMLAWLYIRLSPKIPTTFGL

Peptide

KMLAWLYIR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page