top of page

CircRNA

Gene

chr12|107751414|107756965|-|3|circRNA|PRDM4|NM_012406|5,4,3

PRDM4

Open Reading Frame (ORF)

MVPKVFIPVMAMRWPWTQQSLWRTFLGLPAQFRQMEWQRSLRWTVLQASIPKSQMAPEVMNLCLWIL

Peptide

MVPKVFIPVMAMR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page