top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|103267852|103269853|-|2|circRNA|C12orf42|ENST00000547347.5|8,7

C12orf42

Open Reading Frame (ORF)

LLHPAPAFLKENKTSDTYSNNGIADQLGLHTKESYP

Peptide

LLHPAPAFLKENK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page