top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|101768036|101788589|-|8|circRNA|GNPTAB|NM_024312|11,10,9,8,7,6,5,4

GNPTAB

Open Reading Frame (ORF)

LCQTVPRAAQVPGLRMAIVTRLVIIQPAIGMVGIALRNPWEKHNGTY

Peptide

LCQTVPR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page