top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|101366557|101367976|+|2|circRNA|UTP20|ENST00000261637.4|47,48

UTP20

Open Reading Frame (ORF)

LLHLSLKTSKIKSSGECVLEMLDPFVSLLIDCLGSMDVKKSSSPSTRSTSTTPELPSASPNSSSRWTESCCEQENQHAHIY

Peptide

KSSSPSTR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page