top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr12|100600381|100612141|+|3|circRNA|GAS2L3|NM_001303130|3,4,5

GAS2L3

Open Reading Frame (ORF)

MRKVPCKKDAASGSFFARDNTANFLHWCRDIGVDETYLFESEGLGMVWRRSASKSSESSDSQTRTRIG

Peptide

DIGVDETYLFESEGLGMVWR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page