top of page

CircRNA

Gene

chr11|9856733|9858225|-|1|ciRNA|SBF2|ENST00000617179.4|16

SBF2

CircRNA UID

ciSBF2(16)

Open Reading Frame (ORF)

MLILTHLESIHRANTCHCFFVSHSKEVYPGASPRLGTSETIDIPALHKL

Peptide

EVYPGASPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

NA

Potential Cryptic Translation

false

bottom of page