top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|93736693|93738499|-|3|circRNA|TAF1D|ENST00000323981.6|5,4,3

TAF1D

Open Reading Frame (ORF)

MITLLIAAYLKLSVSLTHLKGRKETPFENLFVHLKVFTQVIHQVTHLLNQYH

Peptide

MITLLIAAYLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page