top of page

CircRNA

Gene

chr11|92352095|92355404|+|1|circRNA|FAT3|ENST00000409404.6|1

FAT3

CircRNA UID

circFAT3(1)

Open Reading Frame (ORF)

LQQTQILVPMENSTTTLKIKLISFQFTPRVVSSP

Peptide

LQQTQILVPMENSTTTLK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

riboCIRC,TransCirc

riboCIRC,TranCirc

Potential Cryptic Translation

false

bottom of page