top of page

CircRNA

Gene

chr11|85598656|85626753|-|2|circRNA|DLG2|NM_001142699|3,2

DLG2

Open Reading Frame (ORF)

LEEYCKKLRKPEEQLLKNAVKKVMGIFKSSLFQALLEDSAWISKLNTEVVCNSYLALGLNPAGSN

Peptide

SSLFQALLEDSAWISK

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page