top of page

CircRNA

Gene

chr11|76523154|76526635|+|2|circRNA|C11orf30|ENST00000524490.5|11,12

C11orf30

Open Reading Frame (ORF)

MIVTQPKGIGSTVQPAAKIIPTKIVYGQQGKTQERLPKSLQSQ

Peptide

TQERLPK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page