top of page

CircRNA

Gene

chr11|71075158|71119032|-|6|circRNA|SHANK2|NM_012309|8,7,6,5,4,3

SHANK2

CircRNA UID

circSHANK2(8,7,6,5,4,3)

Open Reading Frame (ORF)

MPRGTRPCTSAPSTTRNAFDLTRMPQCGLQSSGSCVH

Peptide

GTRPCTSAPSTTRNAFDLTR

ORF Found in Long-Read

false

Peptide Length

20

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

7

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page