top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|70420399|70431280|+|5|circRNA|CTTN|ENST00000346329.7|10,11,12,13,14

CTTN

Open Reading Frame (ORF)

LCRPHLSQPRRGCPRAPSMRLCERVWRKIWCADRQTRQMCPWLGSPGEIAAA

Peptide

QMCPWLGSPGEIAAA

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page