top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|70419745|70431280|+|6|circRNA|CTTN|ENST00000346329.7|9,10,11,12,13,14

CTTN

Open Reading Frame (ORF)

LCRPHLSQPRRGCPRAPSMRLLQRFRRQIRYRQGQSG

Peptide

GCPRAPSMR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page