top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|69054032|69062990|+|5|circRNA|TPCN2|NM_139075|2,3,4,5,6

TPCN2

Open Reading Frame (ORF)

LRIRRLLRPFFLLQNSSMMKKTLKCIRWSLPEMARCRGQVGPLH

Peptide

CRGQVGPLH

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page