top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|68403482|68439916|+|14|circRNA|LRP5|ENST00000294304.11|8,9,10,11,12,13,14,15,16,17,18,19,20,21

LRP5

Open Reading Frame (ORF)

MRKVHDELREPDGGPGRGAPLRPEPRHRGLVQQLVQHEGHAVPAGDQC

Peptide

EPDGGPGR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page