top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|68357649|68365702|+|3|circRNA|LRP5|ENST00000294304.11|3,4,5

LRP5

Open Reading Frame (ORF)

LCLLSPSEPFYTCACPTGVQLQDNGRTCKAGTCTGQTGVRRPGLSGQGWMAAPGRSLWTRTFTGPMD

Peptide

AGTCTGQTGVR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page