top of page

McDonnell Genome Institute

Washington University

CircRNA

Gene

chr11|68347846|68416527|+|12|circRNA|LRP5|ENST00000294304.11|2,3,4,5,6,7,8,9,10,11,12,13

LRP5

Open Reading Frame (ORF)

LLFSQKSAISRMIPDDQHSPDLILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPRRSCYLPTAGTYGWWTPAESSWSPPSWSAAWRMRPQWTSSFPREPCTGQT

Peptide

AKDDGTQPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

2

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page